DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and AT3G44970

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_190083.2 Gene:AT3G44970 / 823632 AraportID:AT3G44970 Length:479 Species:Arabidopsis thaliana


Alignment Length:529 Identity:109/529 - (20%)
Similarity:198/529 - (37%) Gaps:138/529 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLW---ISVAILVVI---HWIYKVNKDYNILAFFARRVQTKDGKPLDSLVPMIKGRTVFANCFDL 63
            |.|   ..|.:|||.   ||.|                |..:.|....|.|...|       |.:
plant     3 LFWNTGFCVIVLVVARVGHWWY----------------QWSNPKSNGKLPPGSMG-------FPI 44

  Fly    64 LGKDTD--------QVFTHLRQLAKNSGDSYLQYSMGFS---------NFNVIDAHNAANILNHP 111
            :|:..|        ::..:|::.....|..:....:|..         |..::...|.:.||::|
plant    45 IGETLDFFKPYGFYEISPYLKKKMLRYGPLFRTNILGVKTVVSTDKDVNMEILRQENKSFILSYP 109

  Fly   112 NLITKGVIYNFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFVSQFQGQ 176
            :.:.|.:..:.|  ||:.|.:       |.....:|    |.:|:.                :|.
plant   110 DGLMKPLGKDSL--FLKIGNI-------HKHIKQIT----LHLLSS----------------EGL 145

  Fly   177 NEVVVSLKDRISRFTLNSICETAMGIKLD--EMAEKGDRYRANFHIIDEGLTRRIVNPLY----- 234
            ...::...||::|..|:|..:|.   :||  :...|         :|...||.::::.|.     
plant   146 KRKILKDMDRVTREHLSSKAKTG---RLDVKDAVSK---------LIIAHLTPKMMSNLKPQTQA 198

  Fly   235 ------------WDDCVYNMFTGHKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTADDDI 287
                        |....|.:..|......|....|..|||        ::....|:.::...|| 
plant   199 KLMGIFKAFTFDWFRTSYLISAGKGLYNTLWACREGMREI--------KDIYTMRKTSEEKYDD- 254

  Fly   288 CVIRKKRFAMLDTLI-CAEKDG-LIDDIGISEEVDTLMAEGYDTTS----IGLVFGLMNMSLYAA 346
                     .|:|.| .:||.| |:::..|...:.||.....||||    :.:.|.|.|..: .|
plant   255 ---------FLNTAIEESEKAGELLNENAIITLIFTLSCVTQDTTSKAICLAVKFLLENPKV-LA 309

  Fly   347 EQELCYQEIQEHILDDLSNLNLSQL-SKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLIL 410
            |.:..::.|.|...|....:...:. .|:.:....|.|::|:....|::.|:.:::.|:: |..:
plant   310 ELKKEHEVILESREDKEGGVTWEEYRHKMTFTNMVINESLRITNLAPMLFRKAVKDVEIK-GYTI 373

  Fly   411 PKRSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMK 475
            |....:.|....:|.:|:.:|:|.||.|.|:..:. |:.....::.|..|.|.|.|.::|..::.
plant   374 PAGWIVMIIPSVVHFDPEIYENPFEFNPWRWEGKE-LRAGSKTFMVFGTGLRQCAGAEFARLQIS 437

  Fly   476 TLMVVILKH 484
                |.|.|
plant   438 ----VFLHH 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 94/465 (20%)
AT3G44970NP_190083.2 p450 34..475 CDD:299894 98/482 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.