DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and CYP709B2

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_182218.2 Gene:CYP709B2 / 819309 AraportID:AT2G46950 Length:572 Species:Arabidopsis thaliana


Alignment Length:447 Identity:103/447 - (23%)
Similarity:187/447 - (41%) Gaps:71/447 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QVFTHLRQLAKNSGDSYLQYSMGFSNFNVIDAHNAANILNHPNLI-----TKGVIYNFLHPFLRT 129
            :|..||:|.....|:::|.:........:.|...|..||::..:.     ||..|..    ....
plant   137 RVLPHLQQWKSQYGETFLYWQGTDPRLCISDHELAKQILSNKFVFFSKSKTKPEILK----LSGN 197

  Fly   130 GVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFVSQFQGQ-----NEVVVSLKDRISR 189
            |::......|...|.:|...|.:|.|....::.:..:.:...:::.|     .|..|.:.....|
plant   198 GLIFVNGLDWVRHRRILNPAFSMDKLKLMTQLMVDCTFRMFLEWKKQRNGVETEQFVLISREFKR 262

  Fly   190 FTLNSICETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYNMFTGH-------- 246
            .|.:.|...|.|   ...||..:.:::...:  :......:..||:....|.....:        
plant   263 LTADIIATAAFG---SSYAEGIEVFKSQLEL--QKCCAAALTDLYFPGIQYLPTPSNLQIWKLDM 322

  Fly   247 KYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTAD--DDICVIRKKRFAMLDTLIC--AEKD 307
            |.|:::|.:                  ::.|..:::.|  :|:..|      ||.....  :||.
plant   323 KVNSSIKRI------------------IDARLTSESKDYGNDLLGI------MLTAASSNESEKK 363

  Fly   308 GLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHILDDLSNLNL---S 369
            ..||:  |.||..|....|::||:..|.:..|.:||:...||    :::|.:.::.....:   .
plant   364 MSIDE--IIEECKTFFFAGHETTANLLTWSTMLLSLHQDWQE----KLREEVFNECGKDKIPDAE 422

  Fly   370 QLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHVFDIHRNPKYWES-P 433
            ..|||..:.....|::|||..:..:.|...::.:|.| |.:||.:.|.:.:..:||:...|.| .
plant   423 TCSKLKLMNTVFMESLRLYGPVLNLLRLASEDMKLGN-LEIPKGTTIILPIAKMHRDKAVWGSDA 486

  Fly   434 EEFRPERFLPQNCLKR---HPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILKHFKI 487
            ::|.|.||  .|.|.|   ||.|.:.||.|.|.||||.:|:.|.||::.:||:.|::
plant   487 DKFNPMRF--ANGLSRAANHPNALLAFSMGPRACIGQNFAIMEAKTVLAMILQRFRL 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 103/447 (23%)
CYP709B2NP_182218.2 p450 89..571 CDD:299894 103/447 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.