DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and BAS1

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_180239.1 Gene:BAS1 / 817212 AraportID:AT2G26710 Length:520 Species:Arabidopsis thaliana


Alignment Length:413 Identity:101/413 - (24%)
Similarity:174/413 - (42%) Gaps:80/413 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PNLI----TKGVIY--NFLHPFLR----TGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAE 165
            |:||    :|...|  |..||.::    .|:|:...:||...|.:::.|||::.|.....:.:..
plant   114 PDLIREIFSKSEFYEKNEAHPLVKQLEGDGLLSLKGEKWAHHRKIISPTFHMENLKLLVPVVLKS 178

  Fly   166 SLKFVSQFQGQ----NEVVVSLKDRISRFTLNSICETAMGIKLDEMAEKGDRYRANFHIIDEGLT 226
            ....|.::..:    .||.|.:.:.....|.:.|..||.|...::       .||.|.:..:.: 
plant   179 VTDMVDKWSDKLSENGEVEVDVYEWFQILTEDVISRTAFGSSYED-------GRAVFRLQAQQM- 235

  Fly   227 RRIVNPLYWDDCVYNMF-TGHKY---NAALKVVHEFSREIIAKRRVLLEEELENRRATQTADD-- 285
                  |...:....:| .|:::   ...|| ..:..:||   |:.|| :.:|.||  |.|.|  
plant   236 ------LLCAEAFQKVFIPGYRFFPTRGNLK-SWKLDKEI---RKSLL-KLIERRR--QNAIDGE 287

  Fly   286 -DICVIRKKRFAMLDT--LICAEKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAE 347
             :.|    |..|..|.  |:...|:..:.|  |.||..:....|..|||..|.:..:.:|::...
plant   288 GEEC----KEPAAKDLLGLMIQAKNVTVQD--IVEECKSFFFAGKQTTSNLLTWTTILLSMHPEW 346

  Fly   348 QELCYQEI-----------QEHILDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQE 401
            |.....|:           ::|::            ||..|...:.|::||||.|....|:...:
plant   347 QAKARDEVLRVCGSRDVPTKDHVV------------KLKTLSMILNESLRLYPPIVATIRRAKSD 399

  Fly   402 TELENGLILPKRSQINIHVFDIHRNPKYW-ESPEEFRPERF---LPQNCLKRHPYAYIPFSAGQR 462
            .:| .|..:|..:::.|.:..:|.:...| ....||.|.||   :|:  ..:||..:|||..|.|
plant   400 VKL-GGYKIPCGTELLIPIIAVHHDQAIWGNDVNEFNPARFADGVPR--AAKHPVGFIPFGLGVR 461

  Fly   463 NCIGQKYAMQEMKTLMVVILKHF 485
            .||||..|:.:.|..:.|:::.|
plant   462 TCIGQNLAILQAKLTLAVMIQRF 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 101/413 (24%)
BAS1NP_180239.1 CYP734 85..509 CDD:410732 101/413 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.