DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and Cyp4a31

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_964002.2 Gene:Cyp4a31 / 666168 MGIID:3028580 Length:509 Species:Mus musculus


Alignment Length:547 Identity:148/547 - (27%)
Similarity:251/547 - (45%) Gaps:99/547 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MICLLWISV-AILVVIH--WIYKVNKDYNILAF--FARRVQTKDGKPLDSLVPMIK--------- 52
            :.|||.:.| |:.|.:|  |:.|..:.:....|  |....|.|..:.|..:|..|:         
Mouse    24 VFCLLLLLVKAVQVYLHRKWLLKALQQFPSPPFHWFFGHEQFKGDQELQEIVSCIENFPSAFPRW 88

  Fly    53 --GRTVFANCFDLLGKDTDQVFTHLRQLAKNSGDSYLQYSMGFSNFNVIDAHNAANILNHPNLIT 115
              |...:...:|                     ..|::..:|.|:    ...|.|          
Mouse    89 FWGSKAYLTVYD---------------------PDYMKVILGRSD----PKANGA---------- 118

  Fly   116 KGVIYNFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFV----SQFQGQ 176
                |..|.|::..|:|....:.|...|.|||..||.|||..:.: .:|:|::.:    .:..||
Mouse   119 ----YRLLAPWIGYGLLLLNGQSWFQHRKMLTPAFHYDILKTYVK-NMADSIRLMLDKWERLAGQ 178

  Fly   177 NEVVVSLKDRISRFTLNSICETAMGIKLDEMAEKGD-----RYRANFHIIDE--GLTR-RIVNPL 233
            :. .:.:...||..||:::.:.|       .:.||.     .|:.....|.:  .|.. |:.|..
Mouse   179 DS-SIEIFQHISLMTLDTVMKCA-------FSHKGSVQVDGNYKTYLQAIGDLNNLVHSRVRNMF 235

  Fly   234 YWDDCVYNMFT-GHKYNAALKVVHEFSREIIAKRRVLLEE--ELENRRATQTADDDICVIRKKRF 295
            :.:|.:|.:.: |...|.|.::.|:.:..:|..|:..|::  ||||            :.:|:|.
Mouse   236 HQNDTIYKLSSNGRLSNQACQLAHDHTDGVIKMRKDQLQDEGELEN------------IKKKRRL 288

  Fly   296 AMLDTLICA--EKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEH 358
            ..||.|:.|  |.:..:.|..:..||||.|.||:|||:.|:.:....::.:...|:.|.:|:|. 
Mouse   289 DFLDILLFARMENEDSMSDKDLRAEVDTFMIEGHDTTASGVSWIFYALATHPEHQQRCREEVQS- 352

  Fly   359 ILDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHVFDI 423
            :|.|.|::....|.::.|....|||.:||||.:|.:||:........:|..|||..|:.:.::.:
Mouse   353 LLGDGSSITWDHLDQIPYTTMCIKEALRLYPPVPSIGRELSTSVTFPDGCSLPKGVQVTLSIYGL 417

  Fly   424 HRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILKHFKIL 488
            |.|||.|.:||.|.|.||.|.:  .||.::::|||.|.|||||:::||.|:|.::.:.|..|::|
Mouse   418 HHNPKVWPNPEVFDPSRFAPDS--PRHSHSFLPFSGGARNCIGKQFAMSELKVIVALTLLRFELL 480

  Fly   489 PVIDPKSIVFQVG-ITLRFKNKIKVKL 514
            |  ||..:...:. ..|:.||.|.:.|
Mouse   481 P--DPTRVPMSLARFVLKSKNGIYLHL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 129/468 (28%)
Cyp4a31NP_964002.2 p450 52..503 CDD:278495 138/515 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.