DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and cyp4t8

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_954686.2 Gene:cyp4t8 / 387527 ZFINID:ZDB-GENE-031219-3 Length:509 Species:Danio rerio


Alignment Length:554 Identity:155/554 - (27%)
Similarity:260/554 - (46%) Gaps:113/554 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MICLLWISVAILVV---------------IHWIYKVNKDYNILAFFARRVQTKDGKPLDSLVPMI 51
            :.|||.: |.:|:|               .||::...|::.           :||..|:.:|..:
Zfish    22 LACLLTV-VKLLIVRRKGVKTMERFPGPPAHWLFGHVKEFR-----------QDGHDLEKIVKWM 74

  Fly    52 KGRTVFANCFDLLGKDTDQVFTHLRQLAKNSGDSYLQYSMGFS-NFNVIDAHNAANILNHPNLIT 115
            :                      |.|.|         :.:.|. :..|::.|       ||:.: 
Zfish    75 E----------------------LYQFA---------FPLWFGPSLAVLNIH-------HPSYV- 100

  Fly   116 KGVI----------YNFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFV 170
            |.::          |.|..|:|..|:|.:|.:||...|.:||..||.|:|..:.:: |::|.|.:
Zfish   101 KTILTTTEPKDDYAYKFFIPWLGDGLLVSTGQKWFRHRRLLTPGFHYDVLKPYVKL-ISDSTKVM 164

  Fly   171 S---QFQGQNEVVVSLKDRISRFTLNSICETAMGIKLDEMAEKGDR--YRANF---HIIDEGLTR 227
            .   :...::|....|...:|..||:||.:.|.....:...:.|..  .:|.|   |:::   .|
Zfish   165 LDKWEVHSRSEESFELFKHVSLMTLDSIMKCAFSCNSNCQTDSGTNPYIQAVFDLCHLVN---LR 226

  Fly   228 RIVNPLYWDDCVYNMFT-GHKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTADDDICVIR 291
            ..|.| |....::::.. |:::..|..:.|..:.|:|.||:.:|:.|.|..           :::
Zfish   227 FRVFP-YHSKAIFHLSPHGYRFRKAASIAHNHTAEVIRKRKEVLKMEEEQG-----------IVK 279

  Fly   292 KKRFA-MLDTLICA---EKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCY 352
            .:|:. .||.|:.|   .:.||.|: .|..||||.|.||:|||:.|:.:...|::.....||.|.
Zfish   280 NRRYLDFLDILLSARDEHQQGLSDE-DIRAEVDTFMFEGHDTTASGISWIFYNLACNPEHQEKCR 343

  Fly   353 QEIQEHILDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQIN 417
            ||||: .||..:.|....|:|:.|....|||::||:|.:|.:.|:..:.....:|..:|:...|.
Zfish   344 QEIQQ-ALDGKATLEWEDLNKIPYTTMCIKESLRLHPPVPGISRKLTKPLTFFDGRTVPEGCTIG 407

  Fly   418 IHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVIL 482
            :.::.||.|...||:|.:|.|.||||:|...|.|:|::|||||.||||||.:||.|||..:.:.|
Zfish   408 VSIYGIHMNSTVWENPYKFDPLRFLPENVANRSPHAFVPFSAGPRNCIGQNFAMNEMKVAVALTL 472

  Fly   483 KHFKIL--PVIDPKSIVFQVGITLRFKNKIKVKL 514
            |.:.::  |...||.|   ..:.||..|.|.:|:
Zfish   473 KRYYLIKDPDHTPKMI---PQVVLRSLNGIHIKI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 141/476 (30%)
cyp4t8NP_954686.2 p450 46..501 CDD:306555 148/525 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589906
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.