DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:393 Identity:94/393 - (23%)
Similarity:164/393 - (41%) Gaps:74/393 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 FLRTGVLTATEKKWHTRRSMLTRTFH-----------LDILNQFQEIFIAESLKFVSQFQGQN-- 177
            ||..|      :||.|.|:.|:.||.           :.:.|:|.::|            |||  
  Fly   121 FLLDG------QKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVF------------GQNVA 167

  Fly   178 -EVVVSLKDRISRFTLNSICETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYN 241
             ..||.:::.::|||.:.|...|.||:...:.:....:|   .:....||.:.:.|      |..
  Fly   168 KSPVVEVRELLARFTTDVIGTCAFGIECSSLKDPDAEFR---EMGRRSLTEQRLGP------VGI 223

  Fly   242 MFTGHKYNAALKVVHEFSREIIAK------RRVLLEEELENRRATQTADDDICVIRKKRFAMLDT 300
            .|.....|.|.::..:.:.|.|.:      |..:...|..|             ||:..|  :|.
  Fly   224 GFVNSFPNLARRLHMKMTAEPIERFFMRIVRETVAFREQNN-------------IRRNDF--MDQ 273

  Fly   301 LI-CAEKDGLIDDIG---------ISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEI 355
            || ...|..::...|         |:.:.....|.|::|:|..:.|.|..::.....|....:|.
  Fly   274 LIDLKNKPLMVSQSGESVNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKEC 338

  Fly   356 QEHILDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELEN--GLILPKRSQINI 418
            ||.|......||...:..|.||...:.||:|||..:|::.|:.|::.|:..  ..::.|...:.|
  Fly   339 QEVIEKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLI 403

  Fly   419 HVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILK 483
            ....:||:.|.:.:|..|.|:.|.|:...:|....::||..|.|||||.::...:.:..:.:::|
  Fly   404 PCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIK 468

  Fly   484 HFK 486
            .||
  Fly   469 DFK 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 94/393 (24%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 94/393 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.