DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:585 Identity:122/585 - (20%)
Similarity:208/585 - (35%) Gaps:162/585 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLWISVAILVVIHWIYKVNKDYNILAFFAR---RVQTKDGKPLDSLVPMIKGRTVFANCFDLLGK 66
            |:|:.:..:|.:::..:...||    |.:|   .:......|:.:|..::..|..|.:.|..|..
  Fly     3 LIWLLLLTIVTLNFWLRHKYDY----FRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYA 63

  Fly    67 DTDQVFTHLRQLAKNSGDSYLQYSMGFSNFNVIDAHNAANILNHPNLITKGVIYNFLHPFLR--- 128
            |            ..:|.:.:   :||..|     ...|.::..|.||.:.:|.|| :.||.   
  Fly    64 D------------PRNGQAKI---VGFFIF-----QTPALMVRDPELIRQVLIKNF-NNFLNRFE 107

  Fly   129 -------TGVLT---ATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFVSQF-QGQNEVVVS 182
                   .|.||   |....|...|..:::.|   ...:.:::..::.|...|.. |..|.   .
  Fly   108 SADAGDPMGALTLPLAKYHHWKESRQCMSQLF---TSGRMRDVMYSQMLDVASDLEQYLNR---K 166

  Fly   183 LKDRISR-FTLNSICETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYNMFTGH 246
            |.||:.| ..|..:|:                                   ||..|...|:|   
  Fly   167 LGDRLERVLPLGRMCQ-----------------------------------LYTTDVTGNLF--- 193

  Fly   247 KYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTADDDICVIRKKRFAMLDTLICAE------ 305
             |:..:..:.....|:|.|.:     ||.|....:..|........|...:|...:..|      
  Fly   194 -YSLNVGGLRRGRSELITKTK-----ELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYM 252

  Fly   306 -----------KDGLIDDIG-----------------ISEEVDTLMAEGYDTTSIGLVFGLMNMS 342
                       |..||:.:.                 ::.:...::..|::|:|     .||..:
  Fly   253 RHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSS-----ALMGFT 312

  Fly   343 LYAAEQELCYQEIQEHILDDL-------SNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQ 400
            ||...:.   .:|||.:..:|       :.|:...|..|.||.....|.:||||:...:.|:...
  Fly   313 LYELAKA---PDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTS 374

  Fly   401 ETELENGL------ILPKRSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSA 459
            .......|      |:|......|.:..:||:.::|..|..|.||||.|:.....||..||||.|
  Fly   375 SASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGA 439

  Fly   460 GQRNCIGQKYAMQEMKTLMVVILKHFKILPV--------IDPKSIVFQVGITLRFKNKIKVKLVR 516
            |...|||.:..:.::|..:|.|||.:.:...        .:|||.:      |..:|:|.::..|
  Fly   440 GPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFM------LESENEIYLRFCR 498

  Fly   517  516
              Fly   499  498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 109/520 (21%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 111/536 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.