DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and Cyp4a3

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_038965516.1 Gene:Cyp4a3 / 298423 RGDID:631356 Length:511 Species:Rattus norvegicus


Alignment Length:473 Identity:141/473 - (29%)
Similarity:233/473 - (49%) Gaps:48/473 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DLLGKDTDQVFTHLRQLAKNSGDSYLQYSMGFSNFNVI--DAHNAANILNHPNLITKGVIYNFLH 124
            ||..::..||.|.:.:..    .:.||:..| |...|:  |......:|...:....| ||.||.
  Rat    63 DLKDREFQQVLTWVEKFP----GACLQWLSG-SKTRVLLYDPDYVKVVLGRSDPKASG-IYQFLA 121

  Fly   125 PFLRT----GVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFV----SQFQGQNEVVV 181
            |::.:    |:|....|||.....|||..||..||..:.:| :|:|:..:    .:...|:. .:
  Rat   122 PWIVSGTGYGLLLLNGKKWFQHWRMLTPAFHYGILKPYVKI-MADSVSIMLDKWEKLDDQDH-PL 184

  Fly   182 SLKDRISRFTLNSICETAM----GIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYNM 242
            .:...:|..||:::.:.|.    .::||..:..   |......::.....|:.:..|.:..:|||
  Rat   185 EIFHYVSLMTLDTVMKCAFSHQGSVQLDVNSRS---YTKAVEDLNNLTFFRVRSAFYGNSIIYNM 246

  Fly   243 FT-GHKYNAALKVVHEFSREIIAKRRVLL--EEELENRRATQTADDDICVIRKKRFAMLDTLICA 304
            .: |.....|.::.||.:..:|..|:..|  ||||:..|            :|:....||.|:.|
  Rat   247 SSDGRLSRRACQIAHEHTDGVIKMRKAQLQNEEELQKAR------------KKRHLDFLDILLFA 299

  Fly   305 E-KDG-LIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHILDDLSNLN 367
            : :|| .:.|..:..||||.|.||:|||:.|:.:....::.:...||.|.:|:|. ||.|.:::.
  Rat   300 KMEDGKSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEVQS-ILGDGTSVT 363

  Fly   368 LSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHVFDIHRNPKYWES 432
            ...|.:::|....|||.:||||.:|.:.|:........:|..:||.....|.::.:|.||.||.:
  Rat   364 WDHLDQISYTTMCIKEALRLYPPVPSVSRELSSPVTFPDGRSIPKGITTTILIYGLHHNPSYWPN 428

  Fly   433 PEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILKHFKILPVIDPKSI- 496
            |:.|.|.||.|.:  .||.:||:|||.|.|||||:::||.|:|..:.:.|..|::||  ||..| 
  Rat   429 PKVFDPSRFSPDS--PRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLP--DPTRIP 489

  Fly   497 VFQVGITLRFKNKIKVKL 514
            |....:.|:.||.|.::|
  Rat   490 VPMARLVLKSKNGIHLRL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 139/470 (30%)
Cyp4a3XP_038965516.1 CYP4B-like 69..506 CDD:410771 138/464 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.