DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001028858.2 Gene:Cyp4f18 / 290623 RGDID:1305261 Length:524 Species:Rattus norvegicus


Alignment Length:380 Identity:124/380 - (32%)
Similarity:191/380 - (50%) Gaps:17/380 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 VIYNFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFVSQFQ---GQNEV 179
            |.|.||.|:|..|:|.:|..||...|.|||..||.:||..:.:||...:....:::|   .|...
  Rat   123 VFYRFLKPWLGDGLLLSTGDKWSRHRHMLTPAFHFNILKPYVKIFNDSTNIMHAKWQRLASQGSA 187

  Fly   180 VVSLKDRISRFTLNSICETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYNMF- 243
            .:.:.:.||..||:|:.:...... ....||...|......:...:.||..:.|.:.|..|::. 
  Rat   188 RLDMFEHISLMTLDSLQKCVFSFD-SNCQEKPSEYITAILELSALVARRHQSLLLYVDLFYHLTR 251

  Fly   244 TGHKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTADDDI-CVIRKKRFAMLDTLICA--E 305
            .|.::..|.::||:|:..:|.:||..|.:        |..||.: ...:.|....:|.|:.:  |
  Rat   252 DGMRFRKACRLVHDFTDAVIRERRRTLPD--------QGGDDALKAKAKAKTLDFIDVLLLSKDE 308

  Fly   306 KDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHILD-DLSNLNLS 369
            ....:.|..|..|.||.|..|:|||:.||.:.|.|::.:...||.|.||::|.:.| :...:...
  Rat   309 HGEALSDEDIRAEADTFMFGGHDTTASGLSWILYNLAKHPEYQERCRQEVRELLRDREPEEIEWD 373

  Fly   370 QLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHVFDIHRNPKYWESPE 434
            .|::|.:|...|||::||:|....:.|...|:..|.:|.::||.....|.:|..|.||..|..||
  Rat   374 DLAQLPFLTMCIKESLRLHPPATAISRCCTQDIMLPDGRVIPKGVICRISIFGTHHNPAVWPDPE 438

  Fly   435 EFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILKHFKILP 489
            .:.|.||...|...|.|.|:||||||.||||||.:||.|||..:.:.|..|::||
  Rat   439 VYNPFRFDADNGEGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRVLP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 124/380 (33%)
Cyp4f18NP_001028858.2 CYP4F 74..515 CDD:410772 124/380 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348752
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.