DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and CYP4X1

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:428 Identity:119/428 - (27%)
Similarity:215/428 - (50%) Gaps:24/428 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 FNVIDAHNAANILNHPNLITKGVIYNFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQE 160
            |.:.|...|..:|:..:..:: .:..|..|.|..|:......||...|.:||..||.:||..:.|
Human    91 FCIYDPDYAKTLLSRTDPKSQ-YLQKFSPPLLGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIE 154

  Fly   161 IFIAESLKFV----SQFQGQNEVVVSLKDRISRFTLNSICETAMGIKLD-EMAEKGDRYRANFHI 220
            : :|.|:|.:    .:.....:..|.:.:.|:..:|:.|.:.|...:.: :.....|.|......
Human   155 V-MAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFE 218

  Fly   221 IDEGLTRRIVNPLYWDDCVYNMF-TGHKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTAD 284
            :.:.:..|:.:.||..|.::.:. .|:::....:|:::::..||.:|:..|:..::.....    
Human   219 LSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTP---- 279

  Fly   285 DDICVIRKKRFAMLDTLICA--EKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAE 347
                  ::|....||.::.|  |......||.:..||.|.:..|:||.:..:.:.|..::|....
Human   280 ------KRKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEH 338

  Fly   348 QELCYQEIQEHILDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPK 412
            ||.|.:|:: .||.|.|::...||.:::|....||||.||.|::|.:.|...:.....:|..||.
Human   339 QERCREEVR-GILGDGSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPA 402

  Fly   413 RSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTL 477
            ...:.:.::.:|.||..|::|:.|.|.||..:|..:||||||:|||||.||||||::||.|:|..
Human   403 GITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVT 467

  Fly   478 MVVILKHFKILPVIDP-KSIVFQVGITLRFKNKIKVKL 514
            :.:||.||::.|  || :.:.|.....|:.||.:.:.|
Human   468 IALILLHFRVTP--DPTRPLTFPNHFILKPKNGMYLHL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 118/426 (28%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 118/424 (28%)
heme binding region 447..460 10/12 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.