DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and Cyp19a1

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_058781.2 Gene:Cyp19a1 / 25147 RGDID:2457 Length:503 Species:Rattus norvegicus


Alignment Length:466 Identity:107/466 - (22%)
Similarity:193/466 - (41%) Gaps:113/466 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VFTHLRQLAKNSGDSYLQYSMGFSNFN-----------VIDAHNAANILNHPNLITK-------- 116
            :.:|.|.|....|.:...|:..:..|.           :..:.:..:::.|.|.|::        
  Rat    59 LISHGRFLWMGIGSACNYYNKMYGEFMRVWISGEETLIISKSSSMVHVMKHSNYISRFGSKRGLQ 123

  Fly   117 -------GVIYNFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLK------ 168
                   |:|:| .:|.|           |.|.|....:......|.:..|:.: ||:|      
  Rat   124 CIGMHENGIIFN-NNPSL-----------WRTVRPFFMKALTGPGLIRMVEVCV-ESIKQHLDRL 175

  Fly   169 -FVSQFQGQNEVVVSLKDRISRFTLNSICETAMGIKLDE--MAEKGDRYRANFHIIDEGLTRRIV 230
             .|:...|..: ||:|...|...|.|::   .:||.|||  :.:|...|...:..:       ::
  Rat   176 GDVTDNSGYVD-VVTLMRHIMLDTSNTL---FLGIPLDESSIVKKIQGYFNAWQAL-------LI 229

  Fly   231 NP-----LYWDDCVYNMFTGHKYNAALKVVHEFSREIIAKRR--VLLEEELENRRATQTADDDIC 288
            .|     :.|   :|     .||..::|.:.:....::.|:|  |...|:||:           |
  Rat   230 KPNIFFKISW---LY-----RKYERSVKDLKDEIEILVEKKRQKVSSAEKLED-----------C 275

  Fly   289 VIRKKRFAMLDTLICAEKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQ 353
            :    .||  ..||.||:.|.:....:::.:..::....||.|:.|..    |.|..||    |.
  Rat   276 M----DFA--TDLIFAERRGDLTKENVNQCILEMLIAAPDTMSVTLYV----MLLLIAE----YP 326

  Fly   354 EIQEHILDDL------SNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPK 412
            |::..||.::      .::.:..:..|..:..||.|::|..|.:.::.|:.| |.::.:|..:.|
  Rat   327 EVETAILKEIHTVVGDRDIRIGDVQNLKVVENFINESLRYQPVVDLVMRRAL-EDDVIDGYPVKK 390

  Fly   413 RSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYI-PFSAGQRNCIGQKYAMQEMKT 476
            .:.|.:::..:|| .:|:..|.||..|.|     .|..||.|. ||..|.|:|.|:..||..||.
  Rat   391 GTNIILNIGRMHR-LEYFPKPNEFTLENF-----EKNVPYRYFQPFGFGPRSCAGKYIAMVMMKV 449

  Fly   477 LMVVILKHFKI 487
            ::|.:||.|.:
  Rat   450 VLVTLLKRFHV 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 107/466 (23%)
Cyp19a1NP_058781.2 CYP19A1 72..485 CDD:410709 103/453 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.