DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and CYP19A1

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_000094.2 Gene:CYP19A1 / 1588 HGNCID:2594 Length:503 Species:Homo sapiens


Alignment Length:438 Identity:113/438 - (25%)
Similarity:193/438 - (44%) Gaps:99/438 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 SGDSYLQYSMGFSNFNVIDAHNAANI-------LNHPNLITKGVIYNFLHPFLRTGVLTATEKKW 139
            ||:..|..|...|.|::: .||..:.       |....:..||:|:| .:|.|           |
Human    90 SGEETLIISKSSSMFHIM-KHNHYSSRFGSKLGLQCIGMHEKGIIFN-NNPEL-----------W 141

  Fly   140 HTRRSMLTRTFHLDILN---QFQEIFI-AESLKF-------VSQFQGQNEVVVSLKDRISRFTLN 193
            .|     ||.|.:..|:   ..:.:.: |||||.       |:...|..:|:..|: |:...|.|
Human   142 KT-----TRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLR-RVMLDTSN 200

  Fly   194 SICETAMGIKLDEMA----EKG--DRYRANFHIIDEGLTRRIVNP-----LYWDDCVYNMFTGHK 247
            ::   .:.|.|||.|    .:|  |.::|           .::.|     :.|   :|.     |
Human   201 TL---FLRIPLDESAIVVKIQGYFDAWQA-----------LLIKPDIFFKISW---LYK-----K 243

  Fly   248 YNAALKVVHEFSREIIA--KRRVLLEEELENRRATQTADDDICVIRKKRFAMLDTLICAEKDGLI 310
            |..::|.:.:....:||  :||:..||:||.           |:    .||  ..||.|||.|.:
Human   244 YEKSVKDLKDAIEVLIAEKRRRISTEEKLEE-----------CM----DFA--TELILAEKRGDL 291

  Fly   311 DDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHILDDLSNLNLSQLSKLN 375
            ....:::.:..::....||.|:.|.|.|..::.:...:|...:|||..|.:  .::.:..:.||.
Human   292 TRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGE--RDIKIDDIQKLK 354

  Fly   376 YLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHVFDIHRNPKYWESPEEFRPER 440
            .:..||.|:||..|.:.::.|:.| |.::.:|..:.|.:.|.:::..:|| .:::..|.||..|.
Human   355 VMENFIYESMRYQPVVDLVMRKAL-EDDVIDGYPVKKGTNIILNIGRMHR-LEFFPKPNEFTLEN 417

  Fly   441 FLPQNCLKRHPYAYI-PFSAGQRNCIGQKYAMQEMKTLMVVILKHFKI 487
            |     .|..||.|. ||..|.|.|.|:..||..||.::|.:|:.|.:
Human   418 F-----AKNVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 113/438 (26%)
CYP19A1NP_000094.2 CYP19A1 72..485 CDD:410709 113/438 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.