DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and CYP4B1

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001093242.1 Gene:CYP4B1 / 1580 HGNCID:2644 Length:512 Species:Homo sapiens


Alignment Length:551 Identity:152/551 - (27%)
Similarity:247/551 - (44%) Gaps:104/551 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LWISVAILVVIHWIYKVNKDYNILAFFARRVQTKDGKPLDSLVPMIKGRTVFANCFDLL-GKDTD 69
            ||.|..|||              |.|.             .|:.::..|...|...|.. |..|.
Human    15 LWASGLILV--------------LGFL-------------KLIHLLLRRQTLAKAMDKFPGPPTH 52

  Fly    70 QVFTHLRQLAK-NSGDSYLQYS--------------MGFSNFNVIDAHNAANILNHPNLITKGVI 119
            .:|.|..::.: .|.|..:.::              :||.|....|...|......|....   :
Human    53 WLFGHALEIQETGSLDKVVSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPD---V 114

  Fly   120 YNFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFVSQF-----QGQNEV 179
            |:|...::..|:|.....||...|.:||..||.|:|..:..:|...:...:.::     :|::  
Human   115 YDFFLQWIGRGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKS-- 177

  Fly   180 VVSLKDRISRFTLNSICETAMGIKLDEMAEKGD-----RYRANFHIIDEGLT----RRIVNPLYW 235
             ..:...:....||::.:...|        :||     ...:::::....||    :|:|:..|.
Human   178 -FDIFCDVGHMALNTLMKCTFG--------RGDTGLGHSRDSSYYLAVSDLTLLMQQRLVSFQYH 233

  Fly   236 DDCVYNMFT-GHKYNAALKVVHEFSREIIAKRRVLLEEE-----LENRRATQTADDDICVIRKKR 294
            :|.:|.:.. |.::..|.:|.|:.:.::|.:|:..|::|     ::|||               .
Human   234 NDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNRR---------------H 283

  Fly   295 FAMLDTLICAEKDGLIDDIGISE-----EVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQE 354
            ...||.|:.|..:   |||.:|:     ||||.|.||:|||:.|:.:.|..|:||...|..|.:|
Human   284 LDFLDILLGARDE---DDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREE 345

  Fly   355 IQEHILDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIH 419
            ::| ||.|........|.|:.||...|||:.||||.:|.:.||..:.....:|..||..|.|::|
Human   346 VRE-ILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMH 409

  Fly   420 VFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILKH 484
            ::.:|||...|..||.|...||..:|..||||:|::|||||.||||||::||.|||.:..:.|..
Human   410 IYALHRNSAVWPDPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLR 474

  Fly   485 FKILPVIDPKSIVFQV-GITLRFKNKIKVKL 514
            |:.  .:||..:..:: .:.||.||...:.|
Human   475 FEF--SLDPSRLPIKMPQLVLRSKNGFHLHL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 139/492 (28%)
CYP4B1NP_001093242.1 p450 47..501 CDD:306555 139/488 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154882
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.