DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and cyp-31A5

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001343697.1 Gene:cyp-31A5 / 13198891 WormBaseID:WBGene00013381 Length:308 Species:Caenorhabditis elegans


Alignment Length:269 Identity:68/269 - (25%)
Similarity:121/269 - (44%) Gaps:42/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QVFTHLRQ-----------LAKNSGDSYLQYSMG-----------------FSNFNVIDAHNAAN 106
            ||..||.|           :.|...:.::...:|                 |....:..|.....
 Worm    28 QVLKHLNQPRSYPIVGHGLITKPDPEGFMNQVIGMGYLYPDPRMCLLWIGPFPCLMLYSADLVEP 92

  Fly   107 ILNHPNLITKGVIYNFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFVS 171
            |.:....:.||..|..|.|:|...:||:.:::|..:|.:||.|||.|||..|..||..:|...:.
 Worm    93 IFSSTKHLNKGFAYVLLEPWLGISILTSQKEQWRPKRKLLTPTFHYDILKDFLPIFNEQSKILIQ 157

  Fly   172 QF--QGQNEVVVSLKDRISRFTLNSICETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLY 234
            :.  .|..:..|.:...|:..||:.||||:||..:.....:.:.|....|.|::.:::|..|||.
 Worm   158 KLCCLGVADEEVDVLSVITLCTLDIICETSMGKAIGAQLAENNEYVWAVHTINKLISKRTNNPLM 222

  Fly   235 WDDCVYNMF-TGHKYNAALKVVHEFSREIIAKRRVLLEE---ELENRRATQTADDDICVIRKKRF 295
            |:..:||:. .|..:...|.::|:|::::|.:|:..|::   ::|.|.|  .:....|.||..| 
 Worm   223 WNSFIYNLTEDGRTHEKCLHILHDFTKKVIVERKEALQDSDYKMEGRLA--FSRQICCTIRILR- 284

  Fly   296 AMLDTLICA 304
                 ::|:
 Worm   285 -----ILCS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 68/269 (25%)
cyp-31A5NP_001343697.1 p450 36..>261 CDD:325183 55/224 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.