DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and Cyp46a1

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_034140.1 Gene:Cyp46a1 / 13116 MGIID:1341877 Length:500 Species:Mus musculus


Alignment Length:375 Identity:94/375 - (25%)
Similarity:169/375 - (45%) Gaps:66/375 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 KWHTRRSMLTRTFHLDILNQFQEIF--IAESLKFVSQFQGQNEVVVSLKDRISRFTLNSICETAM 200
            :|:.:|.::...|....|....|.|  .||.|..:.:.:...:..||::|.::..|::.:.:.|.
Mouse   133 RWYKQRKVMDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTCATIDILAKAAF 197

  Fly   201 GIKLDEM--AEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYNMFTGHKYNAALKVVHE---FSR 260
            |::...:  |:|                     ||               :.|:||:.|   .||
Mouse   198 GMETSMLLGAQK---------------------PL---------------SQAVKVMLEGISASR 226

  Fly   261 EIIAK----RRVLLEEELENRRATQTADDDICVIRKKRFAM---------LDTLICAEKDGLIDD 312
            ..:||    :|..|.|..|:.|..:....|  .::::|.|:         :.|.|...::|..||
Mouse   227 NTLAKFMPGKRKQLREIRESIRLLRQVGKD--WVQRRREALKRGEDMPADILTQILKAEEGAQDD 289

  Fly   313 IGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHILDDLSNLNLSQLSKLNYL 377
            ..:.:...|....|::|::..|.|.:|.:|...........|:.| ::....:|:...|.:|.||
Mouse   290 EVLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDE-VVGSKRHLDYEDLGRLQYL 353

  Fly   378 GYFIKETMRLYPSIPIMGR-QTLQETELENGLILPKRSQINIHVFDIHRNPKYWESPEEFRPERF 441
            ...:||::||||  |..|. :.|:|..|.:|:.:|..:.:....:.:.|...|:|.|..|.|:||
Mouse   354 SQVLKESLRLYP--PAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRF 416

  Fly   442 LPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILK--HFKILP 489
            .|.....|  :.|.|||.|.|:||||::|..|:|.:|..:|:  .|:::|
Mouse   417 GPGAPKPR--FTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRIEFRLVP 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 94/375 (25%)
Cyp46a1NP_034140.1 p450 34..466 CDD:278495 94/375 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.