DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and Cyp4a32

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001093651.1 Gene:Cyp4a32 / 100040843 MGIID:3717148 Length:509 Species:Mus musculus


Alignment Length:415 Identity:126/415 - (30%)
Similarity:212/415 - (51%) Gaps:46/415 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 IYNFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFV----SQFQGQNEV 179
            ||..|.|::..|:|....:.|...|.|||..||.|||..:.: .:|:|::.:    .:..||:. 
Mouse   118 IYRLLAPWIGYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVK-NMADSIRLMLDKWERLAGQDS- 180

  Fly   180 VVSLKDRISRFTLNSICETAMGIKLDEMAEKGD-----RYRANFHIIDEGLTR----RIVNPLYW 235
            .:.:...||..||:::.:.|       .:.||.     .|:.....|.: |..    |:.|..:.
Mouse   181 SIEIFQHISLMTLDTVMKCA-------FSHKGSVQVDGNYKTYLQAIGD-LNNLFHSRVRNIFHQ 237

  Fly   236 DDCVYNMFT-GHKYNAALKVVHEFSREIIAKRRVLLEE--ELENRRATQTADDDICVIRKKRFAM 297
            :|.:|.:.: |.....|.::.|:.:..:|..|:..|::  ||||            :.:|:|...
Mouse   238 NDTIYRLSSNGRLAKQACQLAHDHTDGVIKMRKDQLQDEGELEN------------IKKKRRLDF 290

  Fly   298 LDTLICA--EKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHIL 360
            ||.|:.|  |....:.|..:..||||.|.||:|||:.|:.:....::.:...|:.|.:|:|. :|
Mouse   291 LDILLFARMENGDSMSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPEHQQRCREEVQS-LL 354

  Fly   361 DDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHVFDIHR 425
            .|.|::....|.::.|....|||.:||||.:|.:.|:........:|..|||..|:.:.::.:|.
Mouse   355 GDGSSITWDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGRSLPKGVQVTLSIYGLHH 419

  Fly   426 NPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILKHFKILPV 490
            |||.|.:||.|.|.||.|.:  .||.::::|||.|.|||||:::||.|:|.::.:.|.||::|| 
Mouse   420 NPKVWPNPEVFDPSRFAPDS--PRHSHSFLPFSGGARNCIGKQFAMSELKVIVALTLLHFELLP- 481

  Fly   491 IDPKSIVFQVG-ITLRFKNKIKVKL 514
             ||..:...:. |.|:.||.|.:.|
Mouse   482 -DPTRVPEPLARIVLKSKNGIYLHL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 125/413 (30%)
Cyp4a32NP_001093651.1 p450 52..503 CDD:278495 125/411 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.