DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaAC45 and Atp6ap1l

DIOPT Version :9

Sequence 1:NP_610470.1 Gene:VhaAC45 / 35944 FlyBaseID:FBgn0262515 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_038958437.1 Gene:Atp6ap1l / 361875 RGDID:1564936 Length:360 Species:Rattus norvegicus


Alignment Length:211 Identity:43/211 - (20%)
Similarity:87/211 - (41%) Gaps:40/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 PVVQRRTRRDTAATTGGIMWKSTNQFQIFYTALLYNGNPITVTDLKLTNSSSTKLSVVMDTSVAD 241
            |.:...|:|.|      :.:|:.....:...||..|    |..|...:|.|.....:.:....|:
  Rat   118 PCILFWTKRIT------VKFKNQTWLDLTDEALGQN----TTVDTGNSNCSEENAVLSLKFGDAE 172

  Fly   242 KPITFDVVYN-GGYFSLSN----------LVYDNN---NFRSSGVNAPTTFSYSCGN-------- 284
            .|...|:.:. ..|..||:          ::::|:   .|.::|:.|.:|:||.|..        
  Rat   173 NPKDIDIRFTLSNYIKLSSQSWFSLHRVEIIFNNSVQATFNATGIYALSTYSYHCQRVSSLRRND 237

  Fly   285 ---LTLESAAVNNMYNTLSFKSLQLQAPFDGTYKEDFPFGDSWDCVGFVTPGILMGLFVVALLLV 346
               |...|..|.:::. ::|...|:|    |...:...|..:.||....:|.:|:||.:..:||:
  Rat   238 ALLLLSSSDDVTSLWE-VTFIDFQIQ----GFSIKGAQFSQARDCSSSFSPAVLIGLAMSLILLL 297

  Fly   347 IMFVGVCWMMDINTMD 362
            ::...:..::.:..:|
  Rat   298 VLAYALHMLIYLRYLD 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaAC45NP_610470.1 ATP-synt_S1 244..376 CDD:368630 29/144 (20%)
Atp6ap1lXP_038958437.1 ATP-synt_S1 177..317 CDD:399083 29/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341988
Domainoid 1 1.000 63 1.000 Domainoid score I10009
eggNOG 1 0.900 - - E1_KOG3868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1111170at2759
OrthoFinder 1 1.000 - - FOG0002234
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12471
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.