DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaAC45 and atp6ap1l

DIOPT Version :9

Sequence 1:NP_610470.1 Gene:VhaAC45 / 35944 FlyBaseID:FBgn0262515 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_002935745.2 Gene:atp6ap1l / 100491948 XenbaseID:XB-GENE-6463386 Length:354 Species:Xenopus tropicalis


Alignment Length:133 Identity:35/133 - (26%)
Similarity:64/133 - (48%) Gaps:19/133 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 YFSLSNLVYDNNN-----FRSSGVNAPTTFSYSCGN----------LTLESAAVNNMYNTLSFKS 303
            :|.|.|:....||     |.::.::||...|:.|.:          |...|...:.....|:|.:
 Frog   180 WFQLHNVQIILNNSVQATFNTTWISAPVGSSFHCHHISSLKKYDALLVPSSGDGSTRLWDLTFLN 244

  Fly   304 LQLQAPFDGTYKEDFPFGDSWDCVGFVTPGILMGLFVVALLLVIMFVGVCWMMDINTMDRFDDPK 368
            .|:|| |:.   ||..||.:.||..:::|.|||||.:..:||:::...:..::.:.::|:....|
 Frog   245 FQIQA-FNA---EDGHFGSARDCTTYMSPAILMGLVMSLILLLVLAYALHMLIHLKSIDKHYQRK 305

  Fly   369 GKT 371
            ..|
 Frog   306 NST 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaAC45NP_610470.1 ATP-synt_S1 244..376 CDD:368630 35/133 (26%)
atp6ap1lXP_002935745.2 ATP-synt_S1 162..312 CDD:368630 35/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9370
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1111170at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47999
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.