DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaAC45 and atp6ap1la

DIOPT Version :9

Sequence 1:NP_610470.1 Gene:VhaAC45 / 35944 FlyBaseID:FBgn0262515 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001373640.1 Gene:atp6ap1la / 100000415 ZFINID:ZDB-GENE-110318-1 Length:323 Species:Danio rerio


Alignment Length:308 Identity:70/308 - (22%)
Similarity:120/308 - (38%) Gaps:72/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PAKCAVGTALFVTFEDAAESREASLE--SHDAAIAAISKQFECKVAYLYLAAPSTAPVVQRRT-- 183
            |...|:.:.:|:....:.|...|.:|  |.||....||.|.....:...|:| :.||:  ||.  
Zfish     7 PMSLALFSFVFLQISSSYEQLSAFVEGSSDDAPSRDISIQDGGSGSSSSLSA-AEAPL--RRALQ 68

  Fly   184 ----------RRDTAATTGGIMWKSTNQFQIFYTALLYNGNPITVTDLKLTNSSSTKLS------ 232
                      ||....:.|.:::...:......|.:|:....:.:   :..|.|...|:      
Zfish    69 PYGWQLDVPPRRKLLQSPGLLLYSPLSVTYNGKTCILFRARKLAI---RYRNHSLVDLTEKTFSP 130

  Fly   233 -VVMDTSVA----DKPI----------------------TFDVVYNGGYFSLSNLVYDNN----- 265
             ..:||..:    ||.|                      ||.......:|:|.|:....|     
Zfish   131 DAPLDTKGSFCSKDKAILNLRFGDVEDLRGLSIRLQMSNTFYESAGQNWFTLDNVHIHYNWTYEA 195

  Fly   266 NFRSSGVNAPTTFSYSC---------GNLTLESAAVNNMYN-TLSFKSLQLQAPFDGTYKEDFPF 320
            .|.::.|.||:|.||.|         ..|.:.||..::..| .::|...|:|| |:   .:...|
Zfish   196 TFNATDVYAPSTNSYHCQHVSSLQKYDTLLVPSANTDHAANWHITFTDFQIQA-FN---VQSSKF 256

  Fly   321 GDSWDCVGFVTPGILMGLFVVALLLVIMFVGVCWMMDINTMDRFDDPK 368
            ..:.||..|.||.|||||....:||:::...:..::.:..:||:::.|
Zfish   257 APASDCATFFTPAILMGLITSLILLLVLAYALHMVVHLKHIDRYEEHK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaAC45NP_610470.1 ATP-synt_S1 244..376 CDD:368630 40/162 (25%)
atp6ap1laNP_001373640.1 ATP-synt_S1 161..310 CDD:399083 39/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582047
Domainoid 1 1.000 71 1.000 Domainoid score I9371
eggNOG 1 0.900 - - E1_KOG3868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1111170at2759
OrthoFinder 1 1.000 - - FOG0002234
OrthoInspector 1 1.000 - - otm24592
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12471
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.