DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and LHX2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_004780.3 Gene:LHX2 / 9355 HGNCID:6594 Length:406 Species:Homo sapiens


Alignment Length:311 Identity:63/311 - (20%)
Similarity:97/311 - (31%) Gaps:118/311 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 LPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANP-------GMAQ 215
            |.|.....|..|...::..:|.      ..:.:..|:...:.|||      |||       |:..
Human   167 LHFEALLQGEYPAHFNHADVAA------AAAAAAAAKSAGLGAAG------ANPLGLPYYNGVGT 219

  Fly   216 LQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAY 280
            :|:.. |:...||.         |..|:..                      ||..:..:.|   
Human   220 VQKGR-PRKRKSPG---------PGADLAA----------------------YNAALSCNEN--- 249

  Fly   281 TNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLS 345
               |:|....|:                   ...|:.|::|.||:|...||..::..|.......
Human   250 ---DAEHLDRDQ-------------------PYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPD 292

  Fly   346 LTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAV 410
            ..:..|:|....|::..:::||||.|||::|        .|.|...|...|              
Human   293 AKDLKQLAQKTGLTKRVLQVWFQNARAKFRR--------NLLRQENTGVDK-------------- 335

  Fly   411 RSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTNAS-SPSGGPVGL 460
             |....|:....|||..:|                  :||| |||..|..|
Human   336 -STDAALQTGTPSGPASEL------------------SNASLSPSSTPTTL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 15/50 (30%)
LHX2NP_004780.3 LIM1_Lhx2 43..106 CDD:188853
LIM2_Lhx2_Lhx9 111..169 CDD:188763 1/1 (100%)
COG5576 <247..378 CDD:227863 42/187 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..270 6/38 (16%)
Homeobox 270..323 CDD:395001 16/52 (31%)
Nuclear localization signal. /evidence=ECO:0000255 307..323 7/15 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..374 16/73 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.