DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and LHX4

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_203129.1 Gene:LHX4 / 89884 HGNCID:21734 Length:390 Species:Homo sapiens


Alignment Length:101 Identity:28/101 - (27%)
Similarity:44/101 - (43%) Gaps:14/101 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 CSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQI 352
            |.:|.....:::....|.|              |.||..|::||..|:..:......:...|.|:
Human   140 CKEDYETAKQNDDSEAGAK--------------RPRTTITAKQLETLKNAYKNSPKPARHVREQL 190

  Fly   353 ATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGR 388
            ::...|....|::||||||||.||:|.....|..|:
Human   191 SSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQ 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 17/50 (34%)
LHX4NP_203129.1 LIM1_Lhx4 30..81 CDD:188852
LIM2_Lhx3_Lhx4 89..144 CDD:188762 1/3 (33%)
Homeobox 160..213 CDD:306543 18/52 (35%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 161..181 6/19 (32%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 199..211 7/11 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..253
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.