Sequence 1: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003649.2 | Gene: | BARX2 / 8538 | HGNCID: | 956 | Length: | 279 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 59/207 - (28%) |
---|---|---|---|
Similarity: | 89/207 - (42%) | Gaps: | 57/207 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 184 DYVHSLSVHARLQHMAAAGR-MHEDQANPGMAQ-------LQEPTPPQAHSSPAKSGSHSPMEPA 240
Fly 241 LDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGG 305
Fly 306 KDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNR 370
Fly 371 RAKWKR--VKAG 380 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 26/50 (52%) |
BARX2 | NP_003649.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 110..137 | 11/55 (20%) | |
Homeobox | 136..189 | CDD:306543 | 27/52 (52%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..279 | 2/3 (67%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |