DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and BARX2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_003649.2 Gene:BARX2 / 8538 HGNCID:956 Length:279 Species:Homo sapiens


Alignment Length:207 Identity:59/207 - (28%)
Similarity:89/207 - (42%) Gaps:57/207 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 DYVHSLSVHARLQHMAAAGR-MHEDQANPGMAQ-------LQEPTPPQAHSSPAKSGSHSPMEPA 240
            ||...||:::....:....: :|....:|.:..       .::|| ..:|..||..|    :..|
Human    37 DYFEKLSLYSVCPSLVVRPKPLHSCTGSPSLRAYPLLSVITRQPT-VISHLVPATPG----IAQA 96

  Fly   241 LDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGG 305
            |             ||..::..:|.....||       |..:|:||    .|....|.:      
Human    97 L-------------SCHQVTEAVSAEAPGGE-------ALASSESE----TEQPTPRQK------ 131

  Fly   306 KDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNR 370
                        |.||.||.||..||:.||::|..:||||..:|..:|.||.|:::|||.|:|||
Human   132 ------------KPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNR 184

  Fly   371 RAKWKR--VKAG 380
            |.|||:  :|.|
Human   185 RMKWKKMVLKGG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
BARX2NP_003649.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..137 11/55 (20%)
Homeobox 136..189 CDD:306543 27/52 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..279 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.