DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and RHOXF2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_115887.1 Gene:RHOXF2 / 84528 HGNCID:30011 Length:288 Species:Homo sapiens


Alignment Length:271 Identity:64/271 - (23%)
Similarity:105/271 - (38%) Gaps:40/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 PTDLSYRRLAELMN---QDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAK 230
            |.|...:.:..|::   .|......::|.:..:....:..|:.|.|      ||....|.....|
Human     3 PPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQP------EPEQGTAAGEKLK 61

  Fly   231 SGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQ 295
            |......|.....|.::|...:|         :....:.|:::.:........||:....:.|.|
Human    62 SAGAQGGEEKDGGGEEKDGGGAG---------VPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQ 117

  Fly   296 SRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSE 360
            .....|.:||.: .||....|..      |||..||.||||.|..:::.|...|.::|.|:.::|
Human   118 YSRPQGAVGGLE-PGNAQQPNVH------AFTPLQLQELERIFQREQFPSEFLRRRLARSMNVTE 175

  Fly   361 VQVKIWFQNRRAKWKRVKAGLTSHGLGRN-----------GTTSGTKIVVPIPVHVNRFAVRSQH 414
            :.|:|||:||||||:|.:..|    :.||           ..|:...|..|:.:...|......|
Human   176 LAVQIWFENRRAKWRRHQRAL----MARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDH 236

  Fly   415 QQLEKMCLSGP 425
            .....:|...|
Human   237 SHSSSLCFPMP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
RHOXF2NP_115887.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..136 24/135 (18%)
Homeobox 140..190 CDD:278475 24/49 (49%)
Nuclear localization signal. /evidence=ECO:0000250 186..195 5/8 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.