DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and ATHB13

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_177136.1 Gene:ATHB13 / 843314 AraportID:AT1G69780 Length:294 Species:Arabidopsis thaliana


Alignment Length:265 Identity:64/265 - (24%)
Similarity:95/265 - (35%) Gaps:80/265 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 HED---QANPGMAQLQEPT---PPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTM 263
            :||   ..:|.:|.|. |:   |...|...:..|..||||                .|.|:.   
plant    20 YEDDHPHQSPSLAPLL-PSCSLPQDLHGFASFLGKRSPME----------------GCCDLE--- 64

  Fly   264 SPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTS 328
            :..|.|||              ||.|||                    ||....|.||    ...
plant    65 TGNNMNGE--------------EDYSDD--------------------GSQMGEKKRR----LNM 91

  Fly   329 EQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTS 393
            ||:..||:.|.....|....:.|:|.:|.|...|:.||||||||:||..:.......|.|...| 
plant    92 EQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDTLKRQFDT- 155

  Fly   394 GTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSGS-TNASSPSGGP 457
                     :......:::.:|:|:...:.     |:.:...|:|...::..|| :|.|..|...
plant   156 ---------LKAENDLLQTHNQKLQAEIMG-----LKNREQTESINLNKETEGSCSNRSDNSSDN 206

  Fly   458 VGLGV 462
            :.|.:
plant   207 LRLDI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 19/50 (38%)
ATHB13NP_177136.1 Homeobox 85..138 CDD:395001 22/56 (39%)
HALZ 140..182 CDD:396657 6/56 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.