DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and MIXL1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001269331.1 Gene:MIXL1 / 83881 HGNCID:13363 Length:240 Species:Homo sapiens


Alignment Length:367 Identity:80/367 - (21%)
Similarity:111/367 - (30%) Gaps:176/367 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 AGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAE 179
            |..||.:.|.|.....|||  .|..||                ||..||..|.|           
Human    15 AAFPAYRAPHAGGALLPPP--SPAAAL----------------LPAPPAGPGPA----------- 50

  Fly   180 LMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVG 244
                               ..||.:..|   ||      |.||    .||..||.:|.:.|    
Human    51 -------------------TFAGFLGRD---PG------PAPP----PPASLGSPAPPKGA---- 79

  Fly   245 MDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQ 309
                                                                             
Human    80 ----------------------------------------------------------------- 79

  Fly   310 GNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKY--LSLTERSQIATSLKLSEVQV------KIW 366
               ::.::..||:||:|::|||..||..|...:|  :.|.||....|.|..|.:|:      ::|
Human    80 ---AAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQLLFSPLFQVW 141

  Fly   367 FQNRRAKWKRVKAGLTSHGLGR-----NGTTSGT-----KIVVPIPVHVNRFAVRSQHQQLEKMC 421
            |||||||.:| ::|.:...|.|     |....||     |..:|:.|.||              |
Human   142 FQNRRAKSRR-QSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVN--------------C 191

  Fly   422 LSGPKPDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVGLGVG 463
            |  |:|:        .:||....|.|...:..:..|:...:|
Human   192 L--PEPN--------GVGGGISDSSSQGQNFETCSPLSEDIG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/58 (41%)
MIXL1NP_001269331.1 Homeobox 89..150 CDD:278475 25/60 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.