DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HB53

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_201471.1 Gene:HB53 / 836803 AraportID:AT5G66700 Length:228 Species:Arabidopsis thaliana


Alignment Length:263 Identity:69/263 - (26%)
Similarity:91/263 - (34%) Gaps:91/263 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 GRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPR 266
            ||:.:||...|.......|.||        .||..:...:|.|.:             |..:..|
plant     4 GRLMDDQMMLGSQVYPYTTQPQ--------NSHCIIVNQIDGGEE-------------SKPVKRR 47

  Fly   267 NYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQL 331
            .      |.|:...:.::.||.:         |.|||                 .|:...|.||:
plant    48 R------KRRSKGSSATNEEDVA---------EIGGM-----------------LRKRKLTDEQV 80

  Fly   332 LELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVK-----AGLTSHGLGRNGT 391
            ..||..|..:..|....:.:||..|.|...||.:|||||||:||..|     |.|.:|       
plant    81 NMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKNKKLEEEYAKLKNH------- 138

  Fly   392 TSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSG-----STNAS 451
                        |.|  .|..| .|||...|.     |.::|| ||.....|.|.     .||:|
plant   139 ------------HDN--VVLGQ-CQLESQILK-----LTEQLS-EAQSEIRKLSERLEEMPTNSS 182

  Fly   452 SPS 454
            |.|
plant   183 SSS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 20/50 (40%)
HB53NP_201471.1 Homeobox 75..125 CDD:395001 21/49 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.