DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HB51

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:178 Identity:41/178 - (23%)
Similarity:72/178 - (40%) Gaps:48/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 SSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW--- 374
            :::|...:::|  .||.||..|||.|..:..|....:.:::..|.|...|:.:|||||||:|   
plant    70 NNNNEMIKKKR--LTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWKAK 132

  Fly   375 ---------------------------KRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRS 412
                                       |:::|.|...||.:...::||     |.|......|  
plant   133 QLEQLYDSLRQEYDVVSREKQMLHDEVKKLRALLRDQGLIKKQISAGT-----IKVSGEEDTV-- 190

  Fly   413 QHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTN---ASSPSGGP 457
               ::..:.::.|:.:   .::|..|.|..:..|..|   ..:.||.|
plant   191 ---EISSVVVAHPRTE---NMNANQITGGNQVYGQYNNPMLVASSGWP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 20/80 (25%)
HB51NP_195999.2 Homeobox 77..130 CDD:395001 20/54 (37%)
HALZ 132..167 CDD:396657 2/34 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.