DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HB-3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:186 Identity:48/186 - (25%)
Similarity:69/186 - (37%) Gaps:49/186 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 QHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVG------MDEDFECSGD 254
            ||.....::|||.|:      ..|:|....|.|          |.|..|      |:.....:|.
plant    26 QHGFMFQQLHEDNAH------HLPSPTSLPSCP----------PHLFYGGGGNYMMNRSMSFTGV 74

  Fly   255 SCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKS 319
            |........||...|...|:.:.|     :.::.|||                    ||......
plant    75 SDHHHLTQKSPTTTNNMNDQDQVG-----EEDNLSDD--------------------GSHMMLGE 114

  Fly   320 RRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK 375
            :::|  ...||:..||:.|.....|....:.|:|.:|.|...|:.||||||||:||
plant   115 KKKR--LNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 19/50 (38%)
HB-3NP_568309.2 HOX 115..168 CDD:197696 20/54 (37%)
HALZ 170..208 CDD:280364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.