DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HB40

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001329011.1 Gene:HB40 / 829827 AraportID:AT4G36740 Length:217 Species:Arabidopsis thaliana


Alignment Length:161 Identity:43/161 - (26%)
Similarity:70/161 - (43%) Gaps:30/161 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 KDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNR 370
            |.|..:....|...|:|:  .|.||:..||..|..:..|....:.::|..|.|...||.:|||||
plant    42 KGSVASADGGNGLFRKRK--LTDEQVNMLEMSFGDEHKLESERKDRLAAELGLDPRQVAVWFQNR 104

  Fly   371 RAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLS- 434
            ||:||..:.....:.| :|...:         |.|::..:.|:..||::...     |..:::. 
plant   105 RARWKNKRLEEEYNKL-KNSHDN---------VVVDKCRLESEVIQLKEQLY-----DAEREIQR 154

  Fly   435 -AEAIGGFEKFSGSTNASSPSGGPVGLGVGV 464
             ||.:.|     ||:|:      |:...|.|
plant   155 LAERVEG-----GSSNS------PISSSVSV 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 19/50 (38%)
HB40NP_001329011.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.