DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HB-8

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_195014.1 Gene:HB-8 / 829424 AraportID:AT4G32880 Length:833 Species:Arabidopsis thaliana


Alignment Length:96 Identity:28/96 - (29%)
Similarity:42/96 - (43%) Gaps:13/96 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 GGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFH-AKKYLSLTERSQIATSLKLSEV-- 361
            |||.....:..||         :...:|.||:..|||.:: ..|..|:..:..|.....||.:  
plant     2 GGGSNNSHNMDNG---------KYVRYTPEQVEALERLYNDCPKPSSMRRQQLIRECPILSNIEP 57

  Fly   362 -QVKIWFQNRRAKWKRVKAGLTSHGLGRNGT 391
             |:|:||||||.:.|:.|.......:.|..|
plant    58 KQIKVWFQNRRCREKQRKEASRLQAVNRKLT 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 19/54 (35%)
HB-8NP_195014.1 Homeobox 15..73 CDD:365835 19/57 (33%)
bZIP <67..106 CDD:269834 6/22 (27%)
START_ArGLABRA2_like 154..369 CDD:176884
MEKHLA 690..832 CDD:378025
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.