DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HAT1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 / 827457 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana


Alignment Length:238 Identity:51/238 - (21%)
Similarity:82/238 - (34%) Gaps:70/238 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 HALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGR 203
            |.|:..|.||.....:.:..|:|...  |:.:|        ...|.::..:.|::.         
plant    20 HPLQLNLKPTSSPMSNLQMFPWNQTL--VSSSD--------QQKQQFLRKIDVNSL--------- 65

  Fly   204 MHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNY 268
                   |....|:|.|           |..||.                   |.||.|:|.:..
plant    66 -------PTTVDLEEET-----------GVSSPN-------------------STISSTVSGKRR 93

  Fly   269 NGEMDKSRNGAYTNSDSEDCSDD-EGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLL 332
            :.|.:.:..|.        |.|| :....|....|...::....|.:...|.|     .:.:|..
plant    94 STEREGTSGGG--------CGDDLDITLDRSSSRGTSDEEEDYGGETCRKKLR-----LSKDQSA 145

  Fly   333 ELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK 375
            .||..|.....|:..::..:|..|.|:..||::|||||||:.|
plant   146 VLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 17/50 (34%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:282474 24/133 (18%)
HOX 134..188 CDD:197696 19/58 (33%)
HALZ 190..233 CDD:128634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.