DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HDG1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_191674.1 Gene:HDG1 / 825287 AraportID:AT3G61150 Length:808 Species:Arabidopsis thaliana


Alignment Length:253 Identity:76/253 - (30%)
Similarity:108/253 - (42%) Gaps:52/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 SCSDISLTMSPRNYNGEMDKSRNGAYTNSD-SEDCSDDEGAQSRHEGG---GMGGKDSQGNGSSS 315
            |.|.:||.:..   ||||  ||||....|: |...|..|..:||.|..   .:.|.|.  :.|..
plant    49 SSSGLSLGLQT---NGEM--SRNGEIMESNVSRKSSRGEDVESRSESDNAEAVSGDDL--DTSDR 106

  Fly   316 NSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK----- 375
            ..|.::|....|.:|:.:||..|....:....:|..::..|.|...|||.||||||.:.|     
plant   107 PLKKKKRYHRHTPKQIQDLESVFKECAHPDEKQRLDLSRRLNLDPRQVKFWFQNRRTQMKTQIER 171

  Fly   376 -----------RVKA-GLTSHGLGRN---GTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGP 425
                       :::| .::.....||   |...|       |..:...::..||.::|...|   
plant   172 HENALLRQENDKLRAENMSVREAMRNPMCGNCGG-------PAVIGEISMEEQHLRIENSRL--- 226

  Fly   426 KPDLRKKLSAEAIGGFEKFSGSTNASS--PSGGPVGLGVGVGVG---VGVGLGVSTPL 478
            |.:|.:..   |:.|  ||.|.:|.|.  |....| ||||||.|   ||.|..:|:||
plant   227 KDELDRVC---ALTG--KFLGRSNGSHHIPDSALV-LGVGVGSGGCNVGGGFTLSSPL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 17/50 (34%)
HDG1NP_191674.1 COG5576 69..185 CDD:227863 30/117 (26%)
Homeobox 113..166 CDD:278475 18/52 (35%)
START_ArGLABRA2_like 314..537 CDD:176884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.