DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Msx1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_112321.2 Gene:Msx1 / 81710 RGDID:620929 Length:303 Species:Rattus norvegicus


Alignment Length:367 Identity:95/367 - (25%)
Similarity:130/367 - (35%) Gaps:127/367 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SSPAGHPAAQQPQAQAQPQPPPPHPPTHAL---EKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLS 173
            :.|||..|.|.|.|.|        ....|:   |:...|.:|..|    |||:..|.        
  Rat    22 AKPAGGGAGQAPGAAA--------ATATAMGTDEEGAKPKVPASL----LPFSVEAL-------- 66

  Fly   174 YRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPME 238
               :|:........|:.| |.....||.|.:......||..     ..|.|.|||...|..|   
  Rat    67 ---MADHRKPGAKESVLV-ASEGAQAAGGSVQHLGTRPGSL-----GAPDAPSSPGPLGHFS--- 119

  Fly   239 PALDVG----MDEDFECSGDSCSDISLT---MSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQS 296
                ||    :.||.....:|...:..|   .|||             ::...:...|.......
  Rat   120 ----VGGLLKLPEDALVKAESPEKLDRTPWMQSPR-------------FSPPPARRLSPPACTLR 167

  Fly   297 RHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEV 361
            :|:                  .:|:.||.||:.|||.|||:|..|:|||:.||::.::||.|:|.
  Rat   168 KHK------------------TNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTET 214

  Fly   362 QVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPK 426
            ||||||||||||.||:                                   |..:|||:.::. |
  Rat   215 QVKIWFQNRRAKAKRL-----------------------------------QEAELEKLKMAA-K 243

  Fly   427 PDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVGLGVGVGVGV 468
            |    .|...|.|          .|.|.|||..:....|..:
  Rat   244 P----MLPPAAFG----------LSFPLGGPAAVAAAAGASL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)
Msx1NP_112321.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.