DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and LHX3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_055379.1 Gene:LHX3 / 8022 HGNCID:6595 Length:402 Species:Homo sapiens


Alignment Length:184 Identity:45/184 - (24%)
Similarity:75/184 - (40%) Gaps:49/184 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 HSSPAK-SGSHSPM-EPALDVG-----MDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAY-- 280
            ||...| |..|:|: |.....|     .|:.|:..|..|:...|.:.|...   :.::::..|  
Human    57 HSKCLKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQV---VRRAQDFVYHL 118

  Fly   281 -------------TNSD---SED----C-SDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRT 324
                         |..:   .||    | :|.|.|:.|                .:.:.::|.||
Human   119 HCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQR----------------EAEATAKRPRT 167

  Fly   325 AFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVK 378
            ..|::||..|:..::.....:...|.|:::...|....|::||||||||.||:|
Human   168 TITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 17/50 (34%)
LHX3NP_055379.1 LIM1_Lhx3b 33..87 CDD:188851 9/29 (31%)
LIM2_Lhx3_Lhx4 95..150 CDD:188762 8/57 (14%)
Homeobox 165..218 CDD:278475 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.