DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and uncx

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_005164261.1 Gene:uncx / 798510 ZFINID:ZDB-GENE-080509-1 Length:483 Species:Danio rerio


Alignment Length:211 Identity:63/211 - (29%)
Similarity:88/211 - (41%) Gaps:34/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PPQAHSSPAKSG--------SHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRN 277
            ||.|....:..|        ||..:           :|.:|....  |....|.:.:|.::.|..
Zfish     9 PPHAQFGGSLGGMVSFPYHLSHHHV-----------YELAGHQLQ--STAAVPFSIDGLLNGSCT 60

  Fly   278 GAYTNSD---SEDCS-DDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREF 338
            .:..||:   |..|. :.:..|.:....|...|||.|      .|.||.||.||..||.|||:.|
Zfish    61 ASVVNSNPLLSSGCGMNGDNQQYKLTDSGDPDKDSPG------CKRRRTRTNFTGWQLEELEKAF 119

  Fly   339 HAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPV 403
            :...|..:..|..:|..|.|.|.:|::|||||||||:  |...|..|.||....|........|:
Zfish   120 NESHYPDVFMREALALRLDLIESRVQVWFQNRRAKWR--KKENTKKGPGRPAHNSHPTTCSGEPM 182

  Fly   404 HVNRFAVRSQHQQLEK 419
            .....| |.:.::|||
Zfish   183 DPEEIA-RRELERLEK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
uncxXP_005164261.1 Homeobox 103..156 CDD:278475 25/52 (48%)
DUF3381 <154..212 CDD:288694 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.