DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and cdx4

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571184.2 Gene:cdx4 / 798281 ZFINID:ZDB-GENE-980526-330 Length:270 Species:Danio rerio


Alignment Length:250 Identity:66/250 - (26%)
Similarity:101/250 - (40%) Gaps:63/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 LSYRRLAELMNQDYVHSLSVHARLQHM--AAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSH 234
            :|..:.::.....:|.::..||:....  |..|...||.....:.      ||.:.|:|..:.|.
Zfish    32 VSTPQYSDFTGYHHVPNMETHAQSAGAWGAPYGAPREDWGAYSLG------PPNSISAPMSNSSP 90

  Fly   235 SPMEPALDVGMDEDFECSGD-----SCSDISLTMSPRNY---NGEMDKSRNGAYTNSDSEDCSDD 291
            .|:.           .||.|     ......|...|.|.   ....::.|..:|.          
Zfish    91 GPVS-----------YCSPDYNTMHGPGSAVLPPPPENIPVAQLSPERERRNSYQ---------- 134

  Fly   292 EGAQSRHEGGGMGGKDSQGNGSSSNSKSRRR---RTAFTSEQLLELEREFHAKKYLSLTERSQIA 353
                       ...|..|   |||..|:|.:   |..:|..|.||||:|||..:|:::..:|::|
Zfish   135 -----------WMSKTVQ---SSSTGKTRTKEKYRVVYTDHQRLELEKEFHFNRYITIRRKSELA 185

  Fly   354 TSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGT-----KIVVPIPV 403
            .:|.|||.||||||||||||.::    |....||::..:.|:     ..|.|:||
Zfish   186 VNLGLSERQVKIWFQNRRAKERK----LIKKKLGQSDGSGGSVHSDPGSVSPLPV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)
cdx4NP_571184.2 Caudal_act 15..138 CDD:282574 22/143 (15%)
Homeobox 155..207 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.