DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hmx1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001106998.1 Gene:hmx1 / 797503 ZFINID:ZDB-GENE-080204-54 Length:282 Species:Danio rerio


Alignment Length:180 Identity:61/180 - (33%)
Similarity:87/180 - (48%) Gaps:33/180 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 CSGDSCSDISLTMSPRNYNGE------MDKSRNGA-YTNSDSE-----------------DCSDD 291
            |...|.:.....:||..:.|.      .::|||.: |:.||.:                 .|:.|
Zfish    61 CVQASSAGFKTEISPLEWKGRETSRSPREESRNSSEYSRSDRDTPLASEPLDGVVDRKMSGCAVD 125

  Fly   292 EGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSL 356
            ||..:|.......|.|:...||   ::.::.||.|:..|:.:||..|..|:|||.:||:.:|.||
Zfish   126 EGDDARQLFDERSGPDTSEPGS---ARKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASL 187

  Fly   357 KLSEVQVKIWFQNRRAKWKR-VKAGLTSHGLGRNGTTSGTKIV-VPIPVH 404
            .|:|.||||||||||.|||| :.|.|.:.....|    ..:|| |||..|
Zfish   188 HLTETQVKIWFQNRRNKWKRQLAADLEAVNFNHN----SQRIVRVPILYH 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)
hmx1NP_001106998.1 Homeobox 153..206 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.