DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and vsx2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_005158862.1 Gene:vsx2 / 796163 ZFINID:ZDB-GENE-001222-1 Length:393 Species:Danio rerio


Alignment Length:153 Identity:48/153 - (31%)
Similarity:69/153 - (45%) Gaps:22/153 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 ISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRR 323
            :|.|:.|..:|..         .:|||:|.|..|...|:           .....|...|.||.|
Zfish   125 LSRTVGPLEHNQS---------ASSDSDDVSSSERKMSK-----------SSLSQSKKRKKRRHR 169

  Fly   324 TAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW-KRVKAGLTSHGLG 387
            |.|||.||.|||:.|:...|..:..|..:|...:|.|.::::||||||||| ||.|....|..:.
Zfish   170 TIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMA 234

  Fly   388 RNGTTSG-TKIVVPIPVHVNRFA 409
            ..|.... .:..:|:|..:.:.|
Zfish   235 EYGLYGAMVRHSIPLPESILKSA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/51 (47%)
vsx2XP_005158862.1 Homeobox 170..221 CDD:278475 23/50 (46%)
OAR 338..355 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.