DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and NKX2-1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001073136.1 Gene:NKX2-1 / 7080 HGNCID:11825 Length:401 Species:Homo sapiens


Alignment Length:440 Identity:106/440 - (24%)
Similarity:149/440 - (33%) Gaps:152/440 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LSARAMVASSALGLTQF---PLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQA 127
            ||.|.:::.|....|.|   .:.:|....|      :...:..||       .|.|.|...|.||
Human    25 LSRRRIMSMSPKHTTPFSVSDILSPLEESY------KKVGMEGGG-------LGAPLAAYRQGQA 76

  Fly   128 QPQPPPPHPPTHALEKQLPPTLPHPLDTR---FLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSL 189
            .       |||.|:::       |.:...   ...::..||||                      
Human    77 A-------PPTAAMQQ-------HAVGHHGAVTAAYHMTAAGV---------------------- 105

  Fly   190 SVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSH-SPMEPALDVGMDEDFECSG 253
               .:|.|.|..|..:.:..|.......:.|...:.|.|...|:: .|..||             
Human   106 ---PQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPA------------- 154

  Fly   254 DSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSS--- 315
                 ||..|.|.:   .|:.|                          ||||..|.|:.|.:   
Human   155 -----ISRFMGPAS---GMNMS--------------------------GMGGLGSLGDVSKNMAP 185

  Fly   316 --NSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV- 377
              ::..|:||..|:..|:.||||.|..:||||..||..:|:.:.|:..||||||||.|.|.||. 
Human   186 LPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQA 250

  Fly   378 --KAG-----LTSHGLGRNGTT-----------SGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSG 424
              ||.     ..|.|.|..|.|           |..::.||:.|...            |.|.:|
Human   251 KDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDG------------KPCQAG 303

  Fly   425 -PKPDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVGLGVGVGVGVGVGLG 473
             |.|      .|.::.|..:......|.:.......:.||.|   |.|||
Human   304 APAP------GAASLQGHAQQQAQHQAQAAQAAAAAISVGSG---GAGLG 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)
NKX2-1NP_001073136.1 Homeobox 194..247 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.