DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Vsx1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001103016.1 Gene:Vsx1 / 689704 RGDID:1305667 Length:369 Species:Rattus norvegicus


Alignment Length:258 Identity:62/258 - (24%)
Similarity:97/258 - (37%) Gaps:63/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 MAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRN 277
            :|.|:...|.....:.|:|..|.|  |||                            |...:|.|
  Rat   107 LADLRLLPPAGPEPAVAQSPVHPP--PAL----------------------------GSQQRSEN 141

  Fly   278 GAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKK 342
              .:.||.:..|:::             .|.:.:.:....|.||.||.||:.||.|||:.|....
  Rat   142 --ISTSDGDSPSEEK-------------NDPKMSLTLGKRKKRRHRTVFTAHQLEELEKAFGEAH 191

  Fly   343 YLSLTERSQIATSLKLSEVQVKIWFQNRRAKW-KRVKAGLTSHGLGRNGTTSG-TKIVVPIPVHV 405
            |..:..|..:|...:|.|.::::||||||||| ||.|....|..:...|.... .:..:|:|   
  Rat   192 YPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLP--- 253

  Fly   406 NRFAVRSQHQQLEKMC------LSGPKPDLRKKLSAEAIGGFEKF-----SGSTNASSPSGGP 457
              .:|.:....|:..|      :.....::||..|.|.:.|..:.     ....:...|..||
  Rat   254 --DSVLNSADSLQGSCAPWLLGMHKKSTEMRKPESEEKLAGLWELDHLRKGAKKDEDGPERGP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/51 (45%)
Vsx1NP_001103016.1 Homeobox 171..224 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.