DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxd9

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001166940.1 Gene:Hoxd9 / 688999 RGDID:1582908 Length:343 Species:Rattus norvegicus


Alignment Length:202 Identity:57/202 - (28%)
Similarity:81/202 - (40%) Gaps:35/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 AAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDE------DFECSGDSCSD 258
            |.||.:..:...|.|    |.|..|.:|.:.|.|.|..........:.      :|.|:......
  Rat   144 ANGRHYGIKPETGAA----PAPSAASTSSSTSSSSSSKRTECSAARESQGSGGPEFPCNSFLRDK 204

  Fly   259 ISLTMSPRNYNGEMDKSRNGAYTNSDSED--CSDDEGAQSRHEGGGMGGKDSQ------------ 309
            .:...:....||.......|..|...||.  |||       |...|...|:.:            
  Rat   205 AAAAAAAAAGNGPGVGIGTGPGTGGSSEPSACSD-------HPSPGCPLKEEEKQPPQPPQQQLD 262

  Fly   310 GNGSSSN----SKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNR 370
            .|..::|    ..:|::|..:|..|.||||:||....||:...|.::|..|.|:|.|||||||||
  Rat   263 PNNPAANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNR 327

  Fly   371 RAKWKRV 377
            |.|.|::
  Rat   328 RMKMKKM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
Hoxd9NP_001166940.1 Hox9_act 1..>155 CDD:282473 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..196 12/55 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..267 11/53 (21%)
HOX 276..328 CDD:197696 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.