DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxa6

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001178016.1 Gene:Hoxa6 / 685732 RGDID:1590236 Length:233 Species:Rattus norvegicus


Alignment Length:140 Identity:50/140 - (35%)
Similarity:69/140 - (49%) Gaps:18/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 GDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSE-----DCSDDEGAQSRHEGG----------- 301
            |.||......:|..:.:|...:...|.|.:...|     |.|..:| ::.||.|           
  Rat    75 GASCFYSDKDLSGASPSGNSKQRGPGDYLHFSPEQQYKPDSSSVQG-KALHEEGTDRKYTSPVYP 138

  Fly   302 GMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIW 366
            .|...:|.. |:...|..||.|..:|..|.||||:|||..:||:...|.:||.:|.|:|.|:|||
  Rat   139 WMQRMNSCA-GAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIW 202

  Fly   367 FQNRRAKWKR 376
            |||||.|||:
  Rat   203 FQNRRMKWKK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
Hoxa6NP_001178016.1 Homeobox 159..212 CDD:395001 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.