DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Nkx6-3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001102925.1 Gene:Nkx6-3 / 685102 RGDID:1597780 Length:262 Species:Rattus norvegicus


Alignment Length:110 Identity:39/110 - (35%)
Similarity:57/110 - (51%) Gaps:4/110 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 GEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLEL 334
            |...|:.|...|.  :.:|..|.|...|  |......::....|.:..|.:..|..||..|:..|
  Rat    95 GSFSKTGNEYPTR--TRNCWADTGQDWR--GSTRPCSNTPDPLSDTIHKKKHTRPTFTGHQIFAL 155

  Fly   335 EREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKA 379
            |:.|...|||:..||:::|.||.::|.|||:||||||.||::..|
  Rat   156 EKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSA 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)
Nkx6-3NP_001102925.1 Homeobox 143..197 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.