DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Mnx1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001258203.1 Gene:Mnx1 / 682076 RGDID:1588091 Length:403 Species:Rattus norvegicus


Alignment Length:415 Identity:110/415 - (26%)
Similarity:144/415 - (34%) Gaps:136/415 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KPFSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLTQFPLYNPWLHGYF 93
            |.|.|::|:|...|..|:..|.|              |:....:|::..|        |...|  
  Rat     5 KNFRIDALLAVDPPRAASTQSAP--------------LALVTSLAATPSG--------PGRGG-- 45

  Fly    94 AQNHERLTHLIAGGCYLPS------SPAGHPAAQQP--QAQAQPQPPPPHPPTHALEKQLP---- 146
                       :||....|      |||...|...|  :.:|:...||.....|......|    
  Rat    46 -----------SGGGGTSSGASRSCSPASSEATAAPGDRLRAESPSPPRLLTAHCALLPKPGFLG 99

  Fly   147 ----------PTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVH-------AR 194
                      |..||.      ..:|.||..|....:......|       :|.:|       |.
  Rat   100 AGGGGGAAGGPGTPHH------HAHPGAAAAAAAAAAAAAAGGL-------ALGLHPGGAQGGAG 151

  Fly   195 LQHMAA--AGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPA----LDVGMDEDFECSG 253
            |...||  ...::...|....|.|....|..::|.|...|:| |..||    |..|..:..:...
  Rat   152 LPAQAALYGHPVYSYSAAAAAAALAGQHPALSYSYPQVQGAH-PAHPADPIKLGAGTFQLDQWLR 215

  Fly   254 DSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSK 318
            .|.:.:.|...|                     |.|..  |||...|                 |
  Rat   216 ASTAGMILPKMP---------------------DFSSQ--AQSNLLG-----------------K 240

  Fly   319 SRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGL-- 381
            .||.||||||:||||||.:|...||||..:|.::||||.|:|.||||||||||.||||.|...  
  Rat   241 CRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQ 305

  Fly   382 ----------TSHGLGRNGTTSGTK 396
                      :..|.|:.||...|:
  Rat   306 AAQEAEKQKGSGGGAGKGGTEEKTE 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 34/50 (68%)
Mnx1NP_001258203.1 Homeobox 244..297 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.