DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and SHOX

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_000442.1 Gene:SHOX / 6473 HGNCID:10853 Length:292 Species:Homo sapiens


Alignment Length:240 Identity:69/240 - (28%)
Similarity:98/240 - (40%) Gaps:59/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 GMAQLQE-PTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKS 275
            |:|:.:| .|...:.....:.|.|.|:....| .:|.|.|         .|.        |...:
Human    42 GLARSRELGTSDSSLQDITEGGGHCPVHLFKD-HVDNDKE---------KLK--------EFGTA 88

  Fly   276 R--NGAYTNSDSEDCSDD-EGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELERE 337
            |  .|.|      :|.:. |..:|..|.|            .:..|.||.||.||.|||.||||.
Human    89 RVAEGIY------ECKEKREDVKSEDEDG------------QTKLKQRRSRTNFTLEQLNELERL 135

  Fly   338 FHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTK------ 396
            |....|.....|.:::..|.|||.:|::||||||||.::.:..:      ..|...||.      
Human   136 FDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQM------HKGVILGTANHLDAC 194

  Fly   397 IVVPIPVHVNRFAVRSQHQQLE-KMCLSG---PKPDLRKKLSAEA 437
            .|.|   :||..|:|...||:: ::.|.|   ..|.|...|:|.|
Human   195 RVAP---YVNMGALRMPFQQVQAQLQLEGVAHAHPHLHPHLAAHA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
SHOXNP_000442.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..119 5/30 (17%)
Homeobox 120..174 CDD:395001 27/53 (51%)
SH3-binding. /evidence=ECO:0000255 242..249
OAR 272..288 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 274..287
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.