DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and pax6b

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_005168876.1 Gene:pax6b / 60639 ZFINID:ZDB-GENE-001031-1 Length:450 Species:Danio rerio


Alignment Length:157 Identity:44/157 - (28%)
Similarity:69/157 - (43%) Gaps:32/157 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 CSGDSCSDI-SLTMSPRNY---------NGEMDK------------SRNGAYTNSDSEDCSDDEG 293
            |:.|:...: |:....||.         :|..||            :|.|.|..:......:.:|
Zfish   144 CTNDNIPSVSSINRVLRNLASEKQQMGADGMYDKLRMLNGQSGTWGTRPGWYPGTSVPGQPNQDG 208

  Fly   294 AQSRHEGGGMGGKDSQGNGSSSNS---------KSRRRRTAFTSEQLLELEREFHAKKYLSLTER 349
            .| :.:.||........||..|:.         |.:|.||:||.||:..||:||....|..:..|
Zfish   209 CQ-QQDNGGENTNSISSNGEDSDETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFAR 272

  Fly   350 SQIATSLKLSEVQVKIWFQNRRAKWKR 376
            .::|..:.|.|.::::||.||||||:|
Zfish   273 ERLAAKIDLPEARIQVWFSNRRAKWRR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 21/50 (42%)
pax6bXP_005168876.1 PAX 23..160 CDD:128645 3/15 (20%)
Homeobox 246..298 CDD:306543 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.