DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxc13b

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571621.2 Gene:hoxc13b / 58063 ZFINID:ZDB-GENE-000822-5 Length:273 Species:Danio rerio


Alignment Length:233 Identity:56/233 - (24%)
Similarity:82/233 - (35%) Gaps:77/233 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 LSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQAN---------PGMAQ--------LQEP 219
            |||.....|..:.|      |...::|..:|.:..::.:         |..|.        |..|
Zfish    75 LSYSHNVNLQQKSY------HPAEKYMETSGALPAEELSSRSKEFAIYPSFASSYQTVPGYLDVP 133

  Fly   220 TPPQAHSSPAKSGSHSPMEP-------ALDVGMDEDFECSGDSCSDISLTMSPRN----YNGEMD 273
            ..|...:.|  ...|..:.|       ||..|.||...||.:......|..|..:    :..||:
Zfish   134 VVPGISAHP--ESRHEALFPMDSYQHWALSNGWDEQLYCSKEQTHFNHLWKSQFSDVVPHQAEMN 196

  Fly   274 KSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREF 338
            ..|.|                                         |::|..:|..||.|||:|:
Zfish   197 GYRRG-----------------------------------------RKKRVPYTKIQLKELEKEY 220

  Fly   339 HAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            .|.|:::...|.:|:.:..|||.||.|||||||.|.|:
Zfish   221 AASKFITKDRRRRISATTSLSERQVTIWFQNRRVKEKK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
hoxc13bNP_571621.2 HoxA13_N 1..107 CDD:289085 8/37 (22%)
Homeobox 204..257 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.