DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxb10a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571616.1 Gene:hoxb10a / 58056 ZFINID:ZDB-GENE-000328-2 Length:279 Species:Danio rerio


Alignment Length:294 Identity:80/294 - (27%)
Similarity:122/294 - (41%) Gaps:54/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 HPPTHAL-----EKQLPPTLPH----PL-------DTRFLPFNPAAAGVAPTDLS-YRRLAELMN 182
            ||..|..     |:..|..|||    |.       |..:...:|......|.|:| :.|:  :.:
Zfish     6 HPFVHGAASWDGEQPSPVQLPHISACPFTSSGRKEDPFYFTLDPTGQARQPLDISAFSRI--MTD 68

  Fly   183 QDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDE 247
            ...::|...| |.:....:|  |:      :..|...|.|:   ||:.| |||..:....:.:..
Zfish    69 MGSLNSADDH-RPETSFYSG--HK------LLSLNTNTDPE---SPSLS-SHSDSQHLHSLSLSA 120

  Fly   248 DFECS-GDSCSDIS-LTMSPRNYNGEMDKSRNG---AYTNSDSEDCSDDEGAQSRHEGGGMGGK- 306
              .|| .|:..|:. |.|....|..:..:||..   ..|.|.|:...||....:.......|.| 
Zfish   121 --PCSETDNKHDMQYLAMESTKYPSQWSESRTNRSIITTLSISQRSKDDIEPNNLQTDFTRGDKT 183

  Fly   307 ----------DSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEV 361
                      ::..||..|....|::|..::..|:||||:||....||:...|.:|:.|:.|::.
Zfish   184 PREKTQDVTLENAANGWLSAKAGRKKRCPYSKHQILELEKEFLFNMYLTRERRLEISRSINLTDR 248

  Fly   362 QVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGT 395
            ||||||||||.|.|:    :|.....|:..||.|
Zfish   249 QVKIWFQNRRMKLKK----MTREHRTRDPGTSFT 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
hoxb10aNP_571616.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..112 9/24 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..187 3/19 (16%)
Homeobox 209..262 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.