DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxb7a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001108563.1 Gene:hoxb7a / 58044 ZFINID:ZDB-GENE-000329-2 Length:227 Species:Danio rerio


Alignment Length:172 Identity:51/172 - (29%)
Similarity:78/172 - (45%) Gaps:26/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 QAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYN-GEMDKSRNGA---YTNS 283
            |..|....:.:.:|:..:..|.:...: .:|.|.|..:..|.|..|. |.:..:.:.:   :.|.
Zfish    39 QRASGYGSASTGAPVSSSSSVSLPSMY-TNGTSLSSHTQGMYPTAYELGAVSLNMHSSLFDHPNL 102

  Fly   284 DSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKS--------------RRRRTAFTSEQLLEL 334
            ......|...|||       .||:.|.....:|..:              :|.|..::..|.|||
Zfish   103 PMVSAGDLCKAQS-------SGKEEQRGYHQNNENNLRIYPWMRSTGADRKRGRQTYSRYQTLEL 160

  Fly   335 EREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            |:|||..:|||...|.:||.:|.|:|.|:||||||||.|||:
Zfish   161 EKEFHFNRYLSRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
hoxb7aNP_001108563.1 Antp-type hexapeptide 134..139 0/4 (0%)
Homeobox 149..201 CDD:278475 28/51 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..227 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.