DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Drgx

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:321 Identity:66/321 - (20%)
Similarity:90/321 - (28%) Gaps:136/321 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDS 285
            ||..|    ..|.|.|..|.||...                             :....||:...
  Fly     7 PPALH----PCGPHPPRLPTLDYPF-----------------------------AATHPYTSYSY 38

  Fly   286 EDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERS 350
            .....||....|                    |.||.||.||.:||.|||..|....|..:..|.
  Fly    39 HPAIHDETFVRR--------------------KQRRNRTTFTLQQLEELETAFAQTHYPDVFTRE 83

  Fly   351 QIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGT-------------------- 395
            .:|..:.|:|.:|::|||||||||::.:..........||.:|.:                    
  Fly    84 DLAMKINLTEARVQVWFQNRRAKWRKAERLKDEQRKRENGESSSSLDKLHDSRESSPDITGEIDD 148

  Fly   396 ---------KIVVPI----------------------------------PVHVNRFAV--RSQHQ 415
                     :...|:                                  |:..|:...  .|..|
  Fly   149 DMDDLPPRQRSHSPLANGQMEQQHSHSHSHSHSRSPGGGMHLDSSDNERPLSSNQLTATPHSASQ 213

  Fly   416 QLEKMCLSGPKPD--LRKKLSAEAIGGFEKFSGSTNASSPS-----------GGPVGLGVG 463
            .|..:....|.|.  .|::.....:||     |....||||           |||:.|..|
  Fly   214 SLGSISAGSPSPSGMHREREHTPLVGG-----GGQGPSSPSNSRNTDSPIEVGGPMSLTTG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/50 (46%)
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 24/51 (47%)
OAR 428..445 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.